PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.166140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family FAR1
Protein Properties Length: 604aa    MW: 68440.2 Da    PI: 8.8557
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.166140.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR171.42.1e-22259345189
            FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89 
                     +fY +YA++vGF+vrk+++kk+ +ng + ++ f+Cskeg+r+ +k+k e  + tr+ +rtgC+a+l   + k+g+++v  ++ +HnH+l
  Cucsa.166140.1 259 RFYVNYATKVGFTVRKQYHKKK-KNGIVSRASFCCSKEGFRQVNKRK-EFVHYTRPISRTGCEASLACLLGKNGQYRVVAFKGNHNHDL 345
                     5***************998886.8999*****************999.99999**********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.8505.4E-5614217IPR000868Isochorismatase-like
SuperFamilySSF524993.14E-5223206IPR000868Isochorismatase-like
PfamPF008572.8E-4240203IPR000868Isochorismatase-like
CDDcd004313.42E-5140195No hitNo description
PfamPF031013.2E-19259345IPR004330FAR1 DNA binding domain
PROSITE profilePS509669.409489521IPR007527Zinc finger, SWIM-type
SMARTSM005754.0E-7496523IPR006564Zinc finger, PMZ-type
PfamPF044343.9E-4497520IPR007527Zinc finger, SWIM-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0019674Biological ProcessNAD metabolic process
GO:0008270Molecular Functionzinc ion binding
GO:0008936Molecular Functionnicotinamidase activity
Sequence ? help Back to Top
Protein Sequence    Length: 604 aa     Download sequence    Send to blast
AHHRLTSPPM DNPKSKPSAA IPSYKKYEIR HRLPNPKVAA LLVIDMQNYF SAMAKPIFPH  60
ILTTIRLCRA ASIPVIFTRH AHASASDNPI LNEWWNGDII LEGTPAAGLI SDLDREDADE  120
VIRKNTYSAF RNTRLEDCLK EKGVEEVIVT GVMTNICCET TARDAFVRGY RVFFSTDATA  180
TVDLELHEAT LKNLAYGFAY LVDCKRLGEI SAMKKTGQPC NNSEVVDVED DREARIDPQL  240
EIVEPVIGMK FISVEETYRF YVNYATKVGF TVRKQYHKKK KNGIVSRASF CCSKEGFRQV  300
NKRKEFVHYT RPISRTGCEA SLACLLGKNG QYRVVAFKGN HNHDLGKMTL KRTINVDMNI  360
SNAQKVHDAD SSRTSFGATM GLINKEVDGR EGTGFVDRDY MNYVPIEKKA RIEKGEVEAL  420
VQFFENKQRD NSSIFYALQH NEDNMVTNIF WTDARSVKQP KTILTNQSST IAKAICDVFP  480
EAQHRLFKYE DSTQTVTCSC MKFTSTGILC SHALKVLDRK NVKRLPASYI LKRWTRDARA  540
SNSQTLEVCG KSTGERYNHL CSKFYQITSL AAEHEKLFEH TSETFVQLLK DLEEMKKNLF  600
CGK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2fq1_B1e-19201954196Isochorismatase
2fq1_A1e-19201954196Isochorismatase
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818960.0LN681896.1 Cucumis melo genomic scaffold, anchoredscaffold00016.
GenBankLN7132640.0LN713264.1 Cucumis melo genomic chromosome, chr_10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004143697.20.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A0A0KLA30.0A0A0A0KLA3_CUCSA; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.14e-26FAR1-related sequence 5